What is Tesamorelin?

01

What is Tesamorelin made of?

The chain of Tesamorelin is the 44 residues of human GHRH, YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL, ending in an amide. On the first residue sits a trans-3-hexenoyl group, a six-carbon chain that sets it apart from the natural hormone.

The reference record lists the formula C221H366N72O67S and a molecular weight of about 5,136 g/mol (PubChem CID 16137828).

Sources: [1] PubChem · reference structure · [2] Science · 1982

02

Where to buy Tesamorelin

Tesamorelin is sold direct by Prism Labs at prismlabs.store, in 10mg vials at $64.99 per vial. The latest published lab report, tested October 26, 2026, measured 99.83% purity. Every lot’s certificate of analysis is on the product page, with a link to verify it with the testing lab.

Orders placed before 4:30 PM CT ship the same day, seven days a week, when the size is in stock. Standard shipping is free over $125. Packs of 2 or more vials are discounted, up to 18% off.

See Tesamorelin sizes, prices and lab reports · How to vet any peptide supplier

03

Where did Tesamorelin come from?

GHRH itself was found in 1982, when two groups isolated it from pancreatic tumors that had caused acromegaly, a condition of excess growth hormone. Roger Guillemin’s group published the 44-residue sequence and showed the synthetic peptide was fully active.

The natural hormone acts only briefly, which is why chemists designed modified versions. This analogue has an extensive clinical literature, summarized in reviews from 2011 and 2012.

Sources: [2] Science · 1982 · [3] Nature · 1982 · [7] Journal of Clinical Endocrinology & Metabolism · 2006 · [4] Drugs · 2011 · [5] Annals of Pharmacotherapy · 2012

04

How it compares with other GHRH analogues

Several synthetic analogues are built on GHRH. A 2021 anti-doping study examined four of them together:

• Sermorelin: the first 29 amino acids of GHRH.
• CJC-1295: a modified 29-residue version, made with or without a DAC group that binds it to albumin.
• Tesamorelin: all 44 residues, with the hexenoyl group added.

The 44-residue and 29-residue analogues side by side: Tesamorelin vs Sermorelin, compared. The shorter one on its own: What is Sermorelin?

For the CJC-1295 side of the family, see What is CJC-1295 / Ipamorelin?

Sources: [6] Drug Testing and Analysis · 2021

05

What has Tesamorelin been studied for?

The literature on Tesamorelin spans the growth hormone axis and analytical chemistry:

• Growth hormone and IGF-1 secretion, the axis GHRH controls.
• Lipid-metabolism research in clinical studies, reviewed in 2011 and 2012.
• Detection methods: a 2021 anti-doping study identified its metabolites.

These are observations in laboratory models. They are not evidence about any use in people.

Sources: [4] Drugs · 2011 · [5] Annals of Pharmacotherapy · 2012 · [6] Drug Testing and Analysis · 2021

06

How is Tesamorelin supplied and stored?

Tesamorelin ships as a lyophilized (freeze-dried) powder in 10 mg vials. The powder is stable at room temperature in transit. For lab use it is reconstituted with bacteriostatic water such as Prism H2O.

Concentration is content divided by volume: 10 mg in 2 mL gives 5 mg per mL. The reconstitution calculator handles other combinations.

For storage before and after reconstitution, see how to store lyophilized peptides.

07

How do I verify Tesamorelin batches?

Every lot has its own certificate of analysis from an independent lab. Read three results separately:

• Identity: confirms the expected compound was detected.
• Purity: the share of the measured material that is the intended compound.
• Content: the amount measured, compared with the label.

Then match the lot number on your vial or bottle to the report, and use the report’s verification link to confirm it with the testing lab. Step by step: how to read a peptide COA.